Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Goat Insulin-like growth factor I (IGF1)

This Recombinant Goat Insulin-like growth factor I (IGF1) spans the amino acid sequence from region 50-119aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-I; Somatomedin

UniProt

P51457

Expression Region

50-119aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Capra hircus (Goat)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology; Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCBP1 Antibody
8C10911-AAT 50 µg

NCBP1 Antibody

Sign In for Pricing
View Details
Recombinant NFE2 Antibody
RC-16586-01 50 μL

Recombinant NFE2 Antibody

Sign In for Pricing
View Details
Recombinant NFE2 Antibody
RC-16586-02 100 µL

Recombinant NFE2 Antibody

Sign In for Pricing
View Details
Recombinant NFE2 Antibody
RC-16586-03 1 mL

Recombinant NFE2 Antibody

Sign In for Pricing
View Details
Trans-Prucalopride N-Oxide
TRC-P143970-25MG 25 mg

Trans-Prucalopride N-Oxide

Sign In for Pricing
View Details
Uncoated Mouse IL-17RA (Interleukin-17 receptor A) ELISA Kit
E-UNEL-M0179-01 5x 96 Tests

Uncoated Mouse IL-17RA (Interleukin-17 receptor A) ELISA Kit

Sign In for Pricing
View Details