Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Goat Insulin-like growth factor I (IGF1)

This Recombinant Goat Insulin-like growth factor I (IGF1) spans the amino acid sequence from region 50-119aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IGF-I; Somatomedin

UniProt

P51457

Expression Region

50-119aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Capra hircus (Goat)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology; Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10-Undecylenic Aldehyde
TRC-U788835-50G 50 g

10-Undecylenic Aldehyde

Sign In for Pricing
View Details
Azilsartan Hydroxy Acid
TRC-A926930-500MG 500 mg

Azilsartan Hydroxy Acid

Sign In for Pricing
View Details
SRPK1 (NM_003137) Human Over-expression Lysate
LC401089 20 µg

SRPK1 (NM_003137) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Atp5g1 activation kit by CRISPRa
GA200329 1 Kit

Mouse Atp5g1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700525 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) (NM_000744) Human Recombinant Protein
TP314597M 100 µg

Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) (NM_000744) Human Recombinant Protein

Sign In for Pricing
View Details