Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain (Cd3e), partial

This Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain (Cd3e), partial spans the amino acid sequence from region 23-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell surface antigen T3/Leu-4 epsilon chain; CD antigen CD3e

UniProt

P22646

Expression Region

23-108aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Saporin
AS13 2688 100 µL

Saporin

Sign In for Pricing
View Details
Mouse TMPRSS13 Recombinant Protein (N-His)
MD724012-01 50 µg

Mouse TMPRSS13 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Mouse TMPRSS13 Recombinant Protein (N-His)
MD724012-02 100 µg

Mouse TMPRSS13 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Mouse TMPRSS13 Recombinant Protein (N-His)
MD724012-03 1 mg

Mouse TMPRSS13 Recombinant Protein (N-His)

Sign In for Pricing
View Details
NDUFB9 (19L15) Mouse Monoclonal antibody
E28PE2438 100 µL

NDUFB9 (19L15) Mouse Monoclonal antibody

Sign In for Pricing
View Details
1-Bromo-8-chloronaphthalene
OR74881-01 5 g

1-Bromo-8-chloronaphthalene

Sign In for Pricing
View Details