Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Fibroblast growth factor 23 (FGF23) (R174Q)

This Recombinant Cat Fibroblast growth factor 23 (FGF23) spans the amino acid sequence from region 1-245aa (R174Q) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A337SEX6

Expression Region

1-245aa (R174Q)

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGTRLGLLVSVLCWVVRAYPNTSPLLGSSWGGLTHLYTATARNSYHLQIHKDGHVDGTPHQTIYSALMIRSEDAGFVVITGVMSQRYLCMDFRGNIFGSHLFSPESCRFRQRTLENGYDVYHSPQHRFLVSLGPAKRAFLPGTNPPPYSQFLSRRNEIPLVHFNTPRPRRHTQSAEDAERDPLNVLKPRPRMTPAPASCSQELPSAEDSGVVASDPLGVLRGNRVNAHAGGMGVERCRPFPKFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sphingomyelin Synthase 2 (SGMS2) CytoSection
TS427444P5 25 Slides

Sphingomyelin Synthase 2 (SGMS2) CytoSection

Sign In for Pricing
View Details
mmu-miR-1264-3p miRNA Antagomir
MBS8319201-01 10 nmol

mmu-miR-1264-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-1264-3p miRNA Antagomir
MBS8319201-02 20 nmol

mmu-miR-1264-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-1264-3p miRNA Antagomir
MBS8319201-03 5x 20 nmol

mmu-miR-1264-3p miRNA Antagomir

Sign In for Pricing
View Details
Topoisomerase II beta (TOP2B) (NM_001068) Human Tagged Lenti ORF Clone
RC224802L4 10 µg

Topoisomerase II beta (TOP2B) (NM_001068) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RCN1 Human qPCR Primer Pair (NM_002901)
HP206514 200 Reactions

RCN1 Human qPCR Primer Pair (NM_002901)

Sign In for Pricing
View Details