Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mus musculus papillomavirus type 1 E4 (E4)

This Recombinant Mus musculus papillomavirus type 1 E4 (E4) spans the amino acid sequence from region 1-105aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

D9D5K6

Expression Region

1-105aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus papillomavirus type 1

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IINTKLLNLLLIAPPQPKKGIKKQPDGPKTTPPRRELFPPTPLTQPPPPETPFGDEAEEYDSDKENDKPASGKLGQALQRLQQDLRDLQDLVNQTTAGITILIGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RAGE protein (N-His)
PKSH034181-01 20 µg

Recombinant Human RAGE protein (N-His)

Sign In for Pricing
View Details
Recombinant Human RAGE protein (N-His)
PKSH034181-02 100 µg

Recombinant Human RAGE protein (N-His)

Sign In for Pricing
View Details
Epicamphor
TRC-E882990-25MG 25 mg

Epicamphor

Sign In for Pricing
View Details
1700012B09Rik (NM_029306) Mouse Tagged ORF Clone
MG200593 10 µg

1700012B09Rik (NM_029306) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD84 Rabbit Polyclonal Antibody
TA374489 100 µL

CD84 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD9 Human Gene Knockout Kit (CRISPR)
KN202000RB 1 Kit

CD9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details