Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mus musculus papillomavirus type 1 E4 (E4)

This Recombinant Mus musculus papillomavirus type 1 E4 (E4) spans the amino acid sequence from region 1-105aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

D9D5K6

Expression Region

1-105aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus papillomavirus type 1

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IINTKLLNLLLIAPPQPKKGIKKQPDGPKTTPPRRELFPPTPLTQPPPPETPFGDEAEEYDSDKENDKPASGKLGQALQRLQQDLRDLQDLVNQTTAGITILIGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SP17 (A-12) : m-IgG1 BP-HRP Bundle
sc-532729 1 Kit

SP17 (A-12) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
FOXD4L2 (NM_001099279) Human Untagged Clone
SC316517 10 µg

FOXD4L2 (NM_001099279) Human Untagged Clone

Sign In for Pricing
View Details
LIN7C AAV Vector (Human) (CMV)
26559101 1 µg

LIN7C AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Nucleoprotein TPR Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-5755R-PerCP-Cy5.5 100 µL

Nucleoprotein TPR Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
3-Methoxymirificin
M31832-01 100 mg

3-Methoxymirificin

Sign In for Pricing
View Details
3-Methoxymirificin
M31832-02 50 mg

3-Methoxymirificin

Sign In for Pricing
View Details