Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Putative anti-FlhC (2) FlhD (4) factor YdiV (ydiV)

This Recombinant Escherichia coli Putative anti-FlhC (2) FlhD (4) factor YdiV (ydiV) spans the amino acid sequence from region 1-237aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P76204

Expression Region

1-237aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKIFLENLYHSDCYFLPIRDNQQVLVGVELITHFSSEDGTVRIPTSRVIAQLTEEQHWQLFSEQLELLKSCQHFFIQHKLFAWLNLTPQVATLLLERDNYAGELLKYPFIELLINENYPHLNEGKDNRGLLSLSQVYPLVLGNLGAGNSTMKAVFDGLFTRVMLDKSFIQQQITHRSFEPFIRAIQAQISPCCNCIIAGGIDTAEILAQITPFDFHALQGCLWPAVPINQITTLVQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp664 Antibody
GWB-MS287H 50 µg

Zfp664 Antibody

Sign In for Pricing
View Details
E2F7 Rabbit pAb, PE-Cy5 conjugated
orb2885345 100 µL

E2F7 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
ENPEP ELISA Kit (Mouse) (OKCD02574)
OKCD02574 96 Well

ENPEP ELISA Kit (Mouse) (OKCD02574)

Sign In for Pricing
View Details
Methyl 5- (chloromethyl) nicotinate hydrochloride
OR1069610-01 100 mg

Methyl 5- (chloromethyl) nicotinate hydrochloride

Sign In for Pricing
View Details
Methyl 5- (chloromethyl) nicotinate hydrochloride
OR1069610-02 250 mg

Methyl 5- (chloromethyl) nicotinate hydrochloride

Sign In for Pricing
View Details
Methyl 5- (chloromethyl) nicotinate hydrochloride
OR1069610-03 1 g

Methyl 5- (chloromethyl) nicotinate hydrochloride

Sign In for Pricing
View Details