Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Cathelicidin antimicrobial peptide (CAMP), partial

This Recombinant Pan troglodytes Cathelicidin antimicrobial peptide (CAMP), partial spans the amino acid sequence from region 134-170aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FALL-39 peptide antibiotic

UniProt

Q1KLX1

Expression Region

134-170aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-UQCRB Antibody
A07958-1 100 µL

Anti-UQCRB Antibody

Sign In for Pricing
View Details
IL11 mouse monoclonal antibody, clone KT8, Aff - Purified
AM20813PU-N 200 µg

IL11 mouse monoclonal antibody, clone KT8, Aff - Purified

Sign In for Pricing
View Details
Rat Protease Activated Receptor 2 (PAR2) ELISA Kit
RD-PAR2-Ra-96Tests 96 Tests

Rat Protease Activated Receptor 2 (PAR2) ELISA Kit

Sign In for Pricing
View Details
Gm5094 Mouse siRNA Oligo Duplex (Locus ID 328839)
SR401568 1 Kit

Gm5094 Mouse siRNA Oligo Duplex (Locus ID 328839)

Sign In for Pricing
View Details
GSTO1 Recombinant Antibody, PE Conjugated
bsm-62273R-PE-01 20 µL

GSTO1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
GSTO1 Recombinant Antibody, PE Conjugated
bsm-62273R-PE-02 100 µL

GSTO1 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details