Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas syringae pv. tomato Copper resistance protein C (copC)

This Recombinant Pseudomonas syringae pv. tomato Copper resistance protein C (copC) spans the amino acid sequence from region 25-126aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P12376

Expression Region

25-126aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Pseudomonas syringae pv. tomato

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PLEKHB2 Antibody
NBP2-68994 100 µL

Rabbit Polyclonal PLEKHB2 Antibody

Sign In for Pricing
View Details
Mouse LIM domain and actin-binding protein 1 (LIMA1) ELISA Kit
abx531013 96 Tests

Mouse LIM domain and actin-binding protein 1 (LIMA1) ELISA Kit

Sign In for Pricing
View Details
GLP1, ID (ZGLP1, GLP1, GATA-type zinc finger protein 1, GATA-like protein 1) (APC) discontinued
036087-APC 200 µL

GLP1, ID (ZGLP1, GLP1, GATA-type zinc finger protein 1, GATA-like protein 1) (APC) discontinued

Sign In for Pricing
View Details
Anti-Human CD15 (Lewisx) Antibody
MBS4159515-01 0.1 mL

Anti-Human CD15 (Lewisx) Antibody

Sign In for Pricing
View Details
Anti-Human CD15 (Lewisx) Antibody
MBS4159515-02 5x 0.1 mL

Anti-Human CD15 (Lewisx) Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus gordonii S-ribosylhomocysteine lyase (luxS)
MBS1352003-01 0.02 mg (E-Coli)

Recombinant Streptococcus gordonii S-ribosylhomocysteine lyase (luxS)

Sign In for Pricing
View Details