Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nacetylglucosamine1phosphotransferase subunit gamma (GNPTG)

This Recombinant Human Nacetylglucosamine1phosphotransferase subunit gamma (GNPTG) spans the amino acid sequence from region 25-305aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GlcNAc-1-phosphotransferase subunit gamma; UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma

UniProt

Q9UJJ9

Expression Region

25-305aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIML1 Antibody, HRP conjugated
A62072-50UG 50 µg

TRIML1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Mouse Cytochrome P450 2J2 (CYP2J2) ELISA Kit
MBS7234737-01 48 Well

Mouse Cytochrome P450 2J2 (CYP2J2) ELISA Kit

Sign In for Pricing
View Details
Mouse Cytochrome P450 2J2 (CYP2J2) ELISA Kit
MBS7234737-02 96 Well

Mouse Cytochrome P450 2J2 (CYP2J2) ELISA Kit

Sign In for Pricing
View Details
Mouse Cytochrome P450 2J2 (CYP2J2) ELISA Kit
MBS7234737-03 5x 96 Well

Mouse Cytochrome P450 2J2 (CYP2J2) ELISA Kit

Sign In for Pricing
View Details
Mouse Cytochrome P450 2J2 (CYP2J2) ELISA Kit
MBS7234737-04 10x 96 Well

Mouse Cytochrome P450 2J2 (CYP2J2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Nanoarchaeum equitans Leucine--tRNA ligase (leuS), partial
MBS1257143 Inquire

Recombinant Nanoarchaeum equitans Leucine--tRNA ligase (leuS), partial

Sign In for Pricing
View Details