Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary neurotrophic factor (CNTF)

This Recombinant Human Ciliary neurotrophic factor (CNTF) spans the amino acid sequence from region 1-200aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P26441

Expression Region

1-200aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf116 siRNA Oligos set (Human)
14124171 3x 5 nmol

C1orf116 siRNA Oligos set (Human)

Sign In for Pricing
View Details
VMN2R62 Adenovirus (Mouse)
49807054 1.0 mL

VMN2R62 Adenovirus (Mouse)

Sign In for Pricing
View Details
APAF1 (Apoptotic Protease-activating Factor 1, APAF-1, KIAA0413)
306301-01 50 µL

APAF1 (Apoptotic Protease-activating Factor 1, APAF-1, KIAA0413)

Sign In for Pricing
View Details
APAF1 (Apoptotic Protease-activating Factor 1, APAF-1, KIAA0413)
306301-02 100 µL

APAF1 (Apoptotic Protease-activating Factor 1, APAF-1, KIAA0413)

Sign In for Pricing
View Details
Leukocyte Elastase Inhibitor (SERPINB1) Antibody
abx321591-01 20 µL

Leukocyte Elastase Inhibitor (SERPINB1) Antibody

Sign In for Pricing
View Details
Leukocyte Elastase Inhibitor (SERPINB1) Antibody
abx321591-02 50 µL

Leukocyte Elastase Inhibitor (SERPINB1) Antibody

Sign In for Pricing
View Details