Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary neurotrophic factor (CNTF)

This Recombinant Human Ciliary neurotrophic factor (CNTF) spans the amino acid sequence from region 1-200aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P26441

Expression Region

1-200aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Vmn1r51 ELISA Kit
ELI-51390r 96 Tests

Rat Vmn1r51 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal MOX1 Antibody (OTI5B11) [Biotin]
NBP2-72770B 0.1 mL

Mouse Monoclonal MOX1 Antibody (OTI5B11) [Biotin]

Sign In for Pricing
View Details
Mouse Gremlin-1 ELISA Kit
EK5784 96 Tests

Mouse Gremlin-1 ELISA Kit

Sign In for Pricing
View Details
CCL3 (NM_002983) Human Over-expression Lysate
LC418970 20 µg

CCL3 (NM_002983) Human Over-expression Lysate

Sign In for Pricing
View Details
Agpat4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4568607 1.0 µg DNA

Agpat4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
MBD3 Protein (N-His, Human)
P505887 100 µg

MBD3 Protein (N-His, Human)

Sign In for Pricing
View Details