Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary neurotrophic factor (CNTF)

This Recombinant Human Ciliary neurotrophic factor (CNTF) spans the amino acid sequence from region 1-200aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P26441

Expression Region

1-200aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12/MC4100/BW2952) thrL Polyclonal Antibody
MBS7178491 Inquire

Rabbit anti-Escherichia coli (strain K12/MC4100/BW2952) thrL Polyclonal Antibody

Sign In for Pricing
View Details
C20orf112 Antibody - middle region
OAAB01016-400UL 400 µL

C20orf112 Antibody - middle region

Sign In for Pricing
View Details
NELF (NSMF) (NM_001130971) Human Tagged Lenti ORF Clone
RC225867L3 10 µg

NELF (NSMF) (NM_001130971) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GGNBP1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
21472064 1.0 µg DNA

GGNBP1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
CDKN1B Antibody
E45M02509G-4 50 µL

CDKN1B Antibody

Sign In for Pricing
View Details
SIRT5 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-9456R-PerCP-Cy5.5 100 µL

SIRT5 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details