Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus Uncharacterized protein

This Recombinant Cricetulus griseus Uncharacterized protein spans the amino acid sequence from region 1-64aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

G3HIE8

Expression Region

1-64aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGAGGRRAQGRFLRDGGFVMNQLSLKLTLCPTPDLGNKAHHDFSSYRNRKTNELQDQGLPNLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FEV Recombinant Protein (Rat)
RP201215 100 µg

FEV Recombinant Protein (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Eps8l2 shRNA (UAS) - Lentiviral mouse Eps8l2 shRNA (UAS, RFP) (25)
GTR15149471 1 Vial

Lentiviral mouse Eps8l2 shRNA (UAS) - Lentiviral mouse Eps8l2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Polyclonal Antibody to Amylin
MBS2111983-01 0.1 mL

Polyclonal Antibody to Amylin

Sign In for Pricing
View Details
Polyclonal Antibody to Amylin
MBS2111983-02 0.2 mL

Polyclonal Antibody to Amylin

Sign In for Pricing
View Details
Polyclonal Antibody to Amylin
MBS2111983-03 0.5 mL

Polyclonal Antibody to Amylin

Sign In for Pricing
View Details
Polyclonal Antibody to Amylin
MBS2111983-04 1 mL

Polyclonal Antibody to Amylin

Sign In for Pricing
View Details