Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fibroblast growth factor 5 (Fgf5)

This Recombinant Mouse Fibroblast growth factor 5 (Fgf5) spans the amino acid sequence from region 21-264aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-5; Heparin-binding growth factor 5; HBGF-5

UniProt

P15656

Expression Region

21-264aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSPVAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVKPKVPLSQPRRSPSPVKYRLKFRFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Variable Volume 12 Channel Micropipette BPIP-316
BPIP-316 1 Unit

Variable Volume 12 Channel Micropipette BPIP-316

Sign In for Pricing
View Details
Pseudotropine 4-Fluorobenzoate Hydrochloride
TRC-P840145-250MG 250 mg

Pseudotropine 4-Fluorobenzoate Hydrochloride

Sign In for Pricing
View Details
Alpha-1-Fetoprotein Antibody
KC-261-01 50 μL

Alpha-1-Fetoprotein Antibody

Sign In for Pricing
View Details
Alpha-1-Fetoprotein Antibody
KC-261-02 100 µL

Alpha-1-Fetoprotein Antibody

Sign In for Pricing
View Details
Alpha-1-Fetoprotein Antibody
KC-261-03 1 mL

Alpha-1-Fetoprotein Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS715959 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details