Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spatacsin (SPG11), partial

This Recombinant Human Spatacsin (SPG11), partial spans the amino acid sequence from region 2095-2387aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Colorectal carcinoma-associated protein; Spastic paraplegia 11 protein

UniProt

Q96JI7

Expression Region

2095-2387aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVGMKLLDKISSVPHGELSCTTELLILAHHCFTLTCHMEGIIRVLQAAHMLTDNHLAPSEEYGLVVRLLTGIGRYNEMTYIFDLLHKKHYFEVLMRKKLDPSGTLKTALLDYIKRCRPGDSEKHNMIALCFSMCREIGENHEAAARIQLKLIESQPWEDSLKDGHQLKQLLLKALTLMLDAAESYAKDSCVRQAQHCQRLTKLITLQIHFLNTGQNTMLINLGRHKLMDCILALPRFYQASIVAEAYDFVPDWAEILYQQVILKGDFNYLEEFKQQRLLKSSIFEEISKKYKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F4/80 Recombinant Rabbit monoclonal Antibody
HA750761 100 µL

F4/80 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human Glycerol-3-phosphate acyltransferase 1, mitochondrial, GPAM ELISA Kit
MBS9323412-01 48 Well

Human Glycerol-3-phosphate acyltransferase 1, mitochondrial, GPAM ELISA Kit

Sign In for Pricing
View Details
Human Glycerol-3-phosphate acyltransferase 1, mitochondrial, GPAM ELISA Kit
MBS9323412-02 96 Well

Human Glycerol-3-phosphate acyltransferase 1, mitochondrial, GPAM ELISA Kit

Sign In for Pricing
View Details
Human Glycerol-3-phosphate acyltransferase 1, mitochondrial, GPAM ELISA Kit
MBS9323412-03 5x 96 Well

Human Glycerol-3-phosphate acyltransferase 1, mitochondrial, GPAM ELISA Kit

Sign In for Pricing
View Details
Human Glycerol-3-phosphate acyltransferase 1, mitochondrial, GPAM ELISA Kit
MBS9323412-04 10x 96 Well

Human Glycerol-3-phosphate acyltransferase 1, mitochondrial, GPAM ELISA Kit

Sign In for Pricing
View Details
SLAMF9 Antibody PE Conjugated
MBS9461048-01 0.1 mL

SLAMF9 Antibody PE Conjugated

Sign In for Pricing
View Details