Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium SPI-1 type 3 secretion system translocon protein SctE (sctE1), partial

This Recombinant Salmonella typhimurium SPI-1 type 3 secretion system translocon protein SctE (sctE1), partial spans the amino acid sequence from region 81-237aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Effector protein SipB

UniProt

Q56019

Expression Region

81-237aa

Tag

Tag-Free

Source

E.coli

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEGQLTLLLGKLMTLLGDVSLSQLESRLAVWQAMIESQKEMGIQVSKEFQTALGEAQEATDLYEASIKKTDTAKSVYDAATKKLTQAQNKLQSLDPADPGYAQAEAAVEQAGKEATEAKEALDKATDATVKAGTDAKAKAEKADNILTKFQGTANAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndufb2 ORF Vector (Rat) (pORF)
ORF071183 1.0 µg DNA

Ndufb2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant ISL1 Antibody
RC-3086-01 50 μL

Recombinant ISL1 Antibody

Sign In for Pricing
View Details
Recombinant ISL1 Antibody
RC-3086-02 100 µL

Recombinant ISL1 Antibody

Sign In for Pricing
View Details
Recombinant ISL1 Antibody
RC-3086-03 1 mL

Recombinant ISL1 Antibody

Sign In for Pricing
View Details
FAH Peptide - N-terminal region (AAP41680)
AAP41680-100UG 100 µg

FAH Peptide - N-terminal region (AAP41680)

Sign In for Pricing
View Details
AADAC Antibody (C-term)
MBS9203843-01 0.08 mL

AADAC Antibody (C-term)

Sign In for Pricing
View Details