Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase RBX1 (RBX1)

This Recombinant Human E3 ubiquitin-protein ligase RBX1 (RBX1) spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

E3 ubiquitin-protein transferase RBX1; Protein ZYP; RING finger protein 75; RING-box protein 1; Rbx1; Regulator of cullins 1; ROC1; E3 ubiquitin-protein transferase RBX1, N-terminally processed

UniProt

P62877

Expression Region

1-108aa

Tag

C-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin; Molecular Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8/803), CF488A conjugate, 0.1mg/mL
BNC880803-500 1x 500 µL

Cytokeratin 8 (KRT8/803), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF594 conjugate, 0.1mg/mL
BNC942349-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF640R conjugate, 0.1mg/mL
BNC402557-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc Oncoprotein (MYC2895R), CF640R conjugate, 0.1mg/mL
BNC402895-500 1x 500 µL

C-Myc Oncoprotein (MYC2895R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF647 conjugate, 0.1mg/mL
BNC471564-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details