Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bos indicus x Bos taurus Alpha-S1-casein (111:E→Missing, △140-149), partial

This Recombinant Bos indicus x Bos taurus Alpha-S1-casein, partial spans the amino acid sequence from region 56-181aa (111:E→Missing, △140-149) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A4W2D9P4

Expression Region

56-181aa (111:E→Missing, △140-149)

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos indicus x Bos taurus (Hybrid cattle)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKDIGSESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKEDVPSERYLGYLIVPNSAEERLHSMKEGIHAQQKEPMIGVLFRQFYQLDAYPSGAWYYVPLGTQYTDAPSFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLITL2 (VASN) (NM_138440) Human Tagged Lenti ORF Clone
RC209865L1 10 µg

SLITL2 (VASN) (NM_138440) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
5-chloro-3- (2-chlorophenyl) -1-phenyl-1H-pyrazole-4-carboxylic acid
OR24744 1 Each

5-chloro-3- (2-chlorophenyl) -1-phenyl-1H-pyrazole-4-carboxylic acid

Sign In for Pricing
View Details
Proteinase Activated Receptor 4 (F2RL3) Human siRNA Oligo Duplex (Locus ID 9002)
SR305941 1 Kit

Proteinase Activated Receptor 4 (F2RL3) Human siRNA Oligo Duplex (Locus ID 9002)

Sign In for Pricing
View Details
ATP4B Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-2433R-BF555 100 µL

ATP4B Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans cpg-4 Protein (aa 19-782)
VAng-Ly3262-inquire Inquire

Recombinant Caenorhabditis Elegans cpg-4 Protein (aa 19-782)

Sign In for Pricing
View Details
N6- (6-Amino) hexyl-ATP – ATTO-Rho12
JBS-NU-805-RHO12 80 µL

N6- (6-Amino) hexyl-ATP – ATTO-Rho12

Sign In for Pricing
View Details