Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bos indicus x Bos taurus Alpha-S1-casein (A68T, M75T, P102L,111:E→Missing), partial

This Recombinant Bos indicus x Bos taurus Alpha-S1-casein, partial spans the amino acid sequence from region 56-126aa (A68T, M75T, P102L,111:E→Missing) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A4W2D9P4

Expression Region

56-126aa (A68T, M75T, P102L,111:E→Missing)

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos indicus x Bos taurus (Hybrid cattle)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKDIGSESTEDQTMEDIKQTEAESISSSEEIVPNSVEQKHIQKEDVLSERYLGYLIVPNSAEERLHSMKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsp60/HSPD1 Rabbit Polyclonal Antibody (Carrier-free)
orb3077870 100 µg

Hsp60/HSPD1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Innovative Grade US Origin Fetal Bovine Tendon Superficial Deep Digital Flexor Fresh
IGFBTDSDFF 1 Each

Innovative Grade US Origin Fetal Bovine Tendon Superficial Deep Digital Flexor Fresh

Sign In for Pricing
View Details
Mouse Abdominal Aortic Smooth Muscle Cells
ARP0443 0.5 Million

Mouse Abdominal Aortic Smooth Muscle Cells

Sign In for Pricing
View Details
GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (FITC)
MBS6175125-01 0.1 mL

GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (FITC)

Sign In for Pricing
View Details
GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (FITC)
MBS6175125-02 5x 0.1 mL

GREM1 (Gremlin 1, Cysteine Knot Superfamily, Homolog (Xenopus laevis), CKTSF1B1, DAND2, DRM, Gremlin, IHG-2, MGC126660, PIG2) (FITC)

Sign In for Pricing
View Details
Lentiviral mouse Tram1 shRNA (UAS) - Lentiviral mouse Tram1 shRNA (UAS, RFP) plasmid
GTR15267661 1 Vial

Lentiviral mouse Tram1 shRNA (UAS) - Lentiviral mouse Tram1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details