Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutaminase kidney isoform, mitochondrial (GLS), partial, Biotinylated

This Recombinant Human Glutaminase kidney isoform, mitochondrial (GLS), partial, Biotinylated spans the amino acid sequence from region 616-669aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GLS; K-glutaminase; L-glutamine amidohydrolase

UniProt

O94925

Expression Region

616-669aa

Tag

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

54.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIRAS3 (DIRAS3, ARHI, NOEY2, RHOI, GTP-binding protein Di-Ras3, Distinct subgroup of the Ras family member 3, Rho-related GTP-binding protein RhoI) (MaxLight 550) discontinued
034649-ML550 100 µL

DIRAS3 (DIRAS3, ARHI, NOEY2, RHOI, GTP-binding protein Di-Ras3, Distinct subgroup of the Ras family member 3, Rho-related GTP-binding protein RhoI) (MaxLight 550) discontinued

Sign In for Pricing
View Details
TOP1 Rabbit mAb Antibody
orb1951509-01 50 µL

TOP1 Rabbit mAb Antibody

Sign In for Pricing
View Details
TOP1 Rabbit mAb Antibody
orb1951509-02 100 µL

TOP1 Rabbit mAb Antibody

Sign In for Pricing
View Details
UROD (4S17) Mouse Monoclonal antibody
E28PE0238 100 µL

UROD (4S17) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Brigatinib analog
B2025-25 25 mg

Brigatinib analog

Sign In for Pricing
View Details
IL3RA Polyclonal Antibody, Cy5 Conjugated
bs-2600R-Cy5-TR 20 µL

IL3RA Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details