Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Outer membrane protein assembly factor BamC (bamC)

This Recombinant Shigella flexneri Outer membrane protein assembly factor BamC (bamC) spans the amino acid sequence from region 25-344aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NlpB

UniProt

P0A904

Expression Region

25-344aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella flexneri

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSDSRYKRQVSGDEAYLEAAPLAELHAPAGMILPVTSGDYAIPVTNGSGAVGKALDIRPPAQPLALVSGARTQFTGDTASLLVENGRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNVISAGLDKSATDAANAAQNRASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPLSDSDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nkx2.6 (NKX2-6) (NM_001136271) Human Over-expression Lysate
LC427879 20 µg

Nkx2.6 (NKX2-6) (NM_001136271) Human Over-expression Lysate

Sign In for Pricing
View Details
8-Oxoadenosine
TRC-O847263-50MG 50 mg

8-Oxoadenosine

Sign In for Pricing
View Details
Recombinant NXF1 Antibody
RC-5115-01 50 μL

Recombinant NXF1 Antibody

Sign In for Pricing
View Details
Recombinant NXF1 Antibody
RC-5115-02 100 µL

Recombinant NXF1 Antibody

Sign In for Pricing
View Details
Recombinant NXF1 Antibody
RC-5115-03 1 mL

Recombinant NXF1 Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD2 Antibody[TS1/8]
E-AB-F1148J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD2 Antibody[TS1/8]

Sign In for Pricing
View Details