Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri Outer membrane protein assembly factor BamC (bamC)

This Recombinant Shigella flexneri Outer membrane protein assembly factor BamC (bamC) spans the amino acid sequence from region 25-344aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NlpB

UniProt

P0A904

Expression Region

25-344aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Shigella flexneri

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSDSRYKRQVSGDEAYLEAAPLAELHAPAGMILPVTSGDYAIPVTNGSGAVGKALDIRPPAQPLALVSGARTQFTGDTASLLVENGRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNVISAGLDKSATDAANAAQNRASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPLSDSDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3106), CF488A conjugate, 0.1mg/mL
BNC883106-100 1x 100 µL

TIGIT / VSTM3 / VSIG9 (Immune Checkpoint for Cancer) (TIGIT/3106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human DPP1 (CTSC) activation kit by CRISPRa
GA100775 1 Kit

Human DPP1 (CTSC) activation kit by CRISPRa

Sign In for Pricing
View Details
Phospholipase C gamma 1 (PLCG1) Human Gene Knockout Kit (CRISPR)
KN216391BN 1 Kit

Phospholipase C gamma 1 (PLCG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VGLL2 Human qPCR Primer Pair (NM_153453)
HP218155 200 Reactions

VGLL2 Human qPCR Primer Pair (NM_153453)

Sign In for Pricing
View Details
LY6A Recombinant Rabbit Monoclonal Antibody [JM53-11]
ET1703-67 100 µL

LY6A Recombinant Rabbit Monoclonal Antibody [JM53-11]

Sign In for Pricing
View Details
(3S,5S,6R)-3-[(3R)-4-Bromo-3-hydroxybutyl]-2-oxo-5,6-diphenyl-4-morpholinecarboxylic Acid tert-Butyl Ester-d2
TRC-B684667-25MG 25 mg

(3S,5S,6R)-3-[(3R)-4-Bromo-3-hydroxybutyl]-2-oxo-5,6-diphenyl-4-morpholinecarboxylic Acid tert-Butyl Ester-d2

Sign In for Pricing
View Details