Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1)

This Recombinant Human Eukaryotic translation initiation factor 4E-binding protein 1 (EIF4EBP1) spans the amino acid sequence from region 2-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4E-BP1; eIF4E-binding protein 1; Phosphorylated heat- and acid-stable protein regulated by insulin 1; PHAS-I

UniProt

Q13541

Expression Region

2-118aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAGT1 Polyclonal Antibody
ABP59396-01 30 µL

NAGT1 Polyclonal Antibody

Sign In for Pricing
View Details
NAGT1 Polyclonal Antibody
ABP59396-02 100 µL

NAGT1 Polyclonal Antibody

Sign In for Pricing
View Details
NAGT1 Polyclonal Antibody
ABP59396-03 200 µL

NAGT1 Polyclonal Antibody

Sign In for Pricing
View Details
Pol III RPC39 (C39-2) Alexa Fluor® 594
sc-23913 AF594 200 µg/mL

Pol III RPC39 (C39-2) Alexa Fluor® 594

Sign In for Pricing
View Details
ADAM6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0041405 3x 1.0 µg

ADAM6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
HNF4G CRISPR Knock Out 293T Cell Line (Human)
23696141 1x 10^6 Cells / 1.0 mL

HNF4G CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details