Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azotobacter vinelandii Uncharacterized protein

This Recombinant Azotobacter vinelandii Uncharacterized protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

C1DPA0

Expression Region

1-133aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSVREAGQKGGEIRKEQLGPEGYSELGHKGGEARKEQLGPEGYSELGHKGGEARKEQLGPEGYSELGKKGGEARKEQLGPEGYSELGHKGGQRVRELIEEGKRAEGQQGSQGGKQENRGQSRQEDQDKGSRKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Oryza sativa (Rice) ndhB2 Polyclonal Antibody
MBS7148080 Inquire

Rabbit anti-Oryza sativa (Rice) ndhB2 Polyclonal Antibody

Sign In for Pricing
View Details
RPS6KL1 Rabbit pAb
E45R27435N-100 100 µL

RPS6KL1 Rabbit pAb

Sign In for Pricing
View Details
PRKCSH Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV655157 1.0 µg DNA

PRKCSH Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Mouse Monoclonal PLZF Antibody (6318100) [Alexa Fluor 700]
FAB2944N 0.1 mL

Mouse Monoclonal PLZF Antibody (6318100) [Alexa Fluor 700]

Sign In for Pricing
View Details
Human ZSCAN5A Pre-designed siRNA Set B
SI019179B 1 Each

Human ZSCAN5A Pre-designed siRNA Set B

Sign In for Pricing
View Details
Letermovir-d8
TMIH-0298-01 1 mg

Letermovir-d8

Sign In for Pricing
View Details