Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azotobacter vinelandii Uncharacterized protein

This Recombinant Azotobacter vinelandii Uncharacterized protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

C1DPA0

Expression Region

1-133aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSVREAGQKGGEIRKEQLGPEGYSELGHKGGEARKEQLGPEGYSELGHKGGEARKEQLGPEGYSELGKKGGEARKEQLGPEGYSELGHKGGQRVRELIEEGKRAEGQQGSQGGKQENRGQSRQEDQDKGSRKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine TNC ELISA Kit
EBT0245 96 Tests

Bovine TNC ELISA Kit

Sign In for Pricing
View Details
InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)
VHB95601 100 μg

InVivoMAb Anti-Human IL1B/IL1F2 (Iv0019)

Sign In for Pricing
View Details
RPF2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2799908 1.0 µg DNA

RPF2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Renal Collecting Duct Cells (Sv40 Transformed) [M-1]
AFG-ELL-2176 > 1x 10^6 Cells / Vial

Mouse Renal Collecting Duct Cells (Sv40 Transformed) [M-1]

Sign In for Pricing
View Details
NSMCE4A (NM_017615) Human Untagged Clone
SC114098 10 µg

NSMCE4A (NM_017615) Human Untagged Clone

Sign In for Pricing
View Details
3-Carboxamidobenzoic acid
TRC-C177718-100MG 100 mg

3-Carboxamidobenzoic acid

Sign In for Pricing
View Details