Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A type 2-A (H2AC18)

This Recombinant Human Histone H2A type 2-A (H2AC18) spans the amino acid sequence from region 2-130aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H2A-clustered histone 18; H2A-clustered histone 19; Histone H2A.2

UniProt

Q6FI13

Expression Region

2-130aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Estrogen Receptor (ER) (BSA & Azide Free) (MaxLight 650) discontinued
E3564-80X-ML650 100 µL

Estrogen Receptor (ER) (BSA & Azide Free) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Citrullinated LL-37 2cit
HY-P5837 1 Each

Citrullinated LL-37 2cit

Sign In for Pricing
View Details
Mouse Monoclonal IL-13 Antibody (32116) [DyLight 650]
FAB213W 0.1 mL

Mouse Monoclonal IL-13 Antibody (32116) [DyLight 650]

Sign In for Pricing
View Details
Guinea-pig TH (Tyrosine Hydroxylase) ValidElisa Kit
EK348116 96 Well

Guinea-pig TH (Tyrosine Hydroxylase) ValidElisa Kit

Sign In for Pricing
View Details
MMP11, CT (Stromelysin-3, SL-3, ST3, Matrix Metalloproteinase-11, MMP-11, STMY3) (MaxLight 405) discontinued
M2427-14E-ML405 100 µL

MMP11, CT (Stromelysin-3, SL-3, ST3, Matrix Metalloproteinase-11, MMP-11, STMY3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Mucolipin 1 shRNA (m) Lentiviral Particles
sc-44520-V 200 µL

Mucolipin 1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details