Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A type 2-A (H2AC18)

This Recombinant Human Histone H2A type 2-A (H2AC18) spans the amino acid sequence from region 2-130aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

H2A-clustered histone 18; H2A-clustered histone 19; Histone H2A.2

UniProt

Q6FI13

Expression Region

2-130aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TEM7/PLXDC1 Antibody [Allophycocyanin]
NBP2-99868APC 0.1 mL

Rabbit Polyclonal TEM7/PLXDC1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Polyclonal Tapbpl antibody - N-terminal region
APR01007G 0.05mg

Polyclonal Tapbpl antibody - N-terminal region

Sign In for Pricing
View Details
1- (4-Fluorophenyl) -2-methylpropan-1-amine hydrochloride
DXC58871-01 100 mg

1- (4-Fluorophenyl) -2-methylpropan-1-amine hydrochloride

Sign In for Pricing
View Details
1- (4-Fluorophenyl) -2-methylpropan-1-amine hydrochloride
DXC58871-02 1 g

1- (4-Fluorophenyl) -2-methylpropan-1-amine hydrochloride

Sign In for Pricing
View Details
ULK1 (NM_003565) Human Over-expression Lysate
LH06755V 100 µg

ULK1 (NM_003565) Human Over-expression Lysate

Sign In for Pricing
View Details
ELISA Kit For Inosine triphosphate pyrophosphatase
E1446b 96 Tests

ELISA Kit For Inosine triphosphate pyrophosphatase

Sign In for Pricing
View Details