Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon epsilon (Ifne)

This Recombinant Mouse Interferon epsilon (Ifne) spans the amino acid sequence from region 22-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN-epsilon; Interferon epsilon-1; Interferon tau-1

UniProt

Q80ZF2

Expression Region

22-192aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cabp4 (NM_144532) Mouse Recombinant Protein
E45M47710M5 20 µg

Cabp4 (NM_144532) Mouse Recombinant Protein

Sign In for Pricing
View Details
Isogibberellic Acid
TRC-I818900-100MG 100 mg

Isogibberellic Acid

Sign In for Pricing
View Details
LIMK2 siRNA (Human)
MBS8236876-01 15 nmol

LIMK2 siRNA (Human)

Sign In for Pricing
View Details
LIMK2 siRNA (Human)
MBS8236876-02 30 nmol

LIMK2 siRNA (Human)

Sign In for Pricing
View Details
LIMK2 siRNA (Human)
MBS8236876-03 5x 30 nmol

LIMK2 siRNA (Human)

Sign In for Pricing
View Details
RAD21 Protein Lysate (Mouse) with C-HA Tag
38411034 100 µg

RAD21 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details