Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial

This Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial spans the amino acid sequence from region 320-487aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EBNA-2; EBV nuclear antigen 2

UniProt

P12978

Expression Region

320-487aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPPWWPPICDPPQPSKTQGQSRGQSRGRGRGRGRGRGKGKSRDKQRKPGGPWRPEPNTSSPSMPELSPVLGLHQGQGAGDSPTPGPSNAAPVCRNSHTATPNVSPIHEPESHNSPEAPILFPDDWYPPSIDPADLDESWDYIFETTESPSSDEDYVEGPSKRPRPSIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC296300 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6009005 3x 1.0 µg

LOC296300 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Cabp4 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6451703 1.0 µg DNA

Cabp4 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Lentiviral human GCSAML shRNA (UAS) - Lentiviral human GCSAML shRNA (UAS, GFP) (100)
GTR15293460 1 Vial

Lentiviral human GCSAML shRNA (UAS) - Lentiviral human GCSAML shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
POU2AF1 Antibody
CSB-PA856023-01 50 μL

POU2AF1 Antibody

Sign In for Pricing
View Details
POU2AF1 Antibody
CSB-PA856023-02 100 µL

POU2AF1 Antibody

Sign In for Pricing
View Details
C6orf25 Rabbit pAb
E45R17786N 50 ul

C6orf25 Rabbit pAb

Sign In for Pricing
View Details