Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial
This Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial spans the amino acid sequence from region 269-387aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Ferric hydroxamate receptor; Ferric hydroxamate uptake; Ferrichrome-iron receptor
UniProt
P06971
Expression Region
269-387aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology; Pharmacology & Drug Discovery
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QNEPETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882332-500 1x 500 µL
Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742289-100 1x 100 µL
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740204-100 1x 100 µL
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details