Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial
Selected Variant
GTR19064845-01
Size: 20 µg
This Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial spans the amino acid sequence from region 269-387aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Ferric hydroxamate receptor; Ferric hydroxamate uptake; Ferrichrome-iron receptor
UniProt
P06971
Expression Region
269-387aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology; Pharmacology & Drug Discovery
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QNEPETGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQN
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2130-100 1x 100 µL
Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), 0.2mg/mL
Sign In for Pricing
View Details 
BNC471604-500 1x 500 µL
CD4 (T-Helper/Inducer Cell Marker) (CD4/1604), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942955-100 1x 100 µL
C1QA / Complement C1q A-Chain (C1QA/2955), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUM1780-50 1x 50 µL
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (N/A), 1mg/mL
Sign In for Pricing
View Details 
M01966-carrier-free 100 µL
Anti-Lin28 LIN28A Rabbit Monoclonal Antibody, Carrier-free
Sign In for Pricing
View Details