Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipocalin-1 (LCN1)

This Recombinant Human Lipocalin-1 (LCN1) spans the amino acid sequence from region 19-176aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tear lipocalin; Tlc; Tear prealbumin; TP; von Ebner gland protein; VEG protein

UniProt

P31025

Expression Region

19-176aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem192 Antibody
orb861612 2 mg

Tmem192 Antibody

Sign In for Pricing
View Details
Os01g0720400 protein Rabbit Polyclonal Antibody
E580557-A-SE 100 µL

Os01g0720400 protein Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ARNT  (3D10)
YF-MA10060 100 ug

Anti-ARNT (3D10)

Sign In for Pricing
View Details
D-Talose-1-13C
VCA84929 100 mg

D-Talose-1-13C

Sign In for Pricing
View Details
Human Hyccin (HCC) ELISA Kit
QY-E04869 96 Tests

Human Hyccin (HCC) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human TRIT1 shRNA (UAS) - Lentiviral human TRIT1 shRNA (UAS, iRFP) (25)
GTR15148274 1 Vial

Lentiviral human TRIT1 shRNA (UAS) - Lentiviral human TRIT1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details