Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza B virus Matrix protein 2 (BM2) (I105V, R109H)

This Recombinant Influenza B virus Matrix protein 2 (BM2) (I105V, R109H) spans the amino acid sequence from region 1-109aa (I105V, R109H) . Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BM2

UniProt

A0A648QDT3

Expression Region

1-109aa (I105V, R109H)

Tag

C-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Influenza B virus

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLEPFQILTICSFILSALHFMAWTIGHLNQIKRGINMKIRIKGPNKETINREVSILRHSYQKEIQAKETMKEVLSDNMEVLNDHIIIEGLSAEEIIKMGETVLEVEELH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf45 Rabbit Polyclonal Antibody
orb512379 100 µg

C12orf45 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H&L) - AF532
BS21594-01 100 µL

Goat Anti-Rabbit IgG (H&L) - AF532

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG (H&L) - AF532
BS21594-02 500 µL

Goat Anti-Rabbit IgG (H&L) - AF532

Sign In for Pricing
View Details
Mouse Monoclonal B220/CD45R Antibody (PTPRC/1460) [Alexa Fluor 488]
NBP2-54465AF488 100 µL

Mouse Monoclonal B220/CD45R Antibody (PTPRC/1460) [Alexa Fluor 488]

Sign In for Pricing
View Details
LentimiRa-mmu-miR-598-5p Vector
mm41478 500 ng

LentimiRa-mmu-miR-598-5p Vector

Sign In for Pricing
View Details
Als2cr12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4454107 1.0 µg DNA

Als2cr12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details