Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2)

This Recombinant Human 3-oxo-5-alpha-steroid 4-dehydrogenase 2 (SRD5A2) spans the amino acid sequence from region 1-254. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-NRG3

UniProt

P31213

Expression Region

1-254aa

Tag

N-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFEDYPKSRKALIPFIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

St3gal6 (NM_018784) Mouse Tagged ORF Clone Lentiviral Particle
MR204835L4V 200 µL

St3gal6 (NM_018784) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZNF93 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2686305 3x 1.0 µg

ZNF93 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
THRSP Protein Lysate
OCOA01016-20UG 20 µg

THRSP Protein Lysate

Sign In for Pricing
View Details
Terumo Agani Needle 25Gx16mm Orange Disposable
SYR6247 100 / PCK

Terumo Agani Needle 25Gx16mm Orange Disposable

Sign In for Pricing
View Details
SLC7A6OS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2163208 1.0 µg DNA

SLC7A6OS sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Sf3b1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4889804 1.0 µg DNA

Sf3b1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details