Recombinant Human G-protein coupled receptor 20 (GPR20) -VLPs (Active)
This Recombinant Human G-protein coupled receptor 20 (GPR20) -VLPs (Active) spans the amino acid sequence from region 1-358aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
UniProt
Q99678
Expression Region
1-358aa
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
The purity information is not available for VLPs proteins.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human GPR20 at 10 μg/mL can bind Anti-GPR20 recombinant antibody. The EC50 is 2.431 - 3.239 ng/mL. The VLPs is negative control.
Form
Lyophilized powder
Molecular Weight
40.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680043-500 1x 500 µL
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details