Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD276 antigen (CD276), partial (Active)

This Recombinant Human CD276 antigen (CD276), partial (Active) spans the amino acid sequence from region 29-245aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4Ig-B7-H3; B7 homolog 3 (B7-H3) ; Costimulatory molecule; CD276

UniProt

Q5ZPR3

Expression Region

29-245aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2 μg/mL can bind Anti-CD276 recombinant antibody. The EC50 is 47.12-54.16 ng/mL.

Form

Lyophilized powder

Molecular Weight

24.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED15 Human shRNA Plasmid Kit (Locus ID 51586)
TR310568 1 Kit

MED15 Human shRNA Plasmid Kit (Locus ID 51586)

Sign In for Pricing
View Details
Bovine Glucosylsphingosine ELISA kit
GTR10428505 96 Well

Bovine Glucosylsphingosine ELISA kit

Sign In for Pricing
View Details
Anti-TrkB / NTRK2
C00813-1mg*5 5x 1mg

Anti-TrkB / NTRK2

Sign In for Pricing
View Details
Mouse Monoclonal COMMD1 Antibody (OTI1F2) [Alexa Fluor 750]
NBP2-72419AF750 0.1 mL

Mouse Monoclonal COMMD1 Antibody (OTI1F2) [Alexa Fluor 750]

Sign In for Pricing
View Details
FGFR3 ELISA Kit (Human)
OKDD00265-96W 96 Tests

FGFR3 ELISA Kit (Human)

Sign In for Pricing
View Details
SCG3 ELISA Kit (Human) (OKEH02209)
OKEH02209 96 Well

SCG3 ELISA Kit (Human) (OKEH02209)

Sign In for Pricing
View Details