What is the catalog number for Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active)?

The catalog number for Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active) is orb2658859.

What sizes are available for Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active)?

Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active) come in?

Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active) is available in 3 different pack sizes.

Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active)

Q: Is Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active) in stock?

Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active) is currently made to order / not held in immediate stock. Contact us for lead time.

This Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active) spans the amino acid sequence from region 1-237aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

Product Name Alternative

Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029

UniProt

P19075

Expression Region

1-237aa

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

The purity information is not available for VLPs proteins.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/mL can bind Anti-TSPAN8 recombinant antibody. The EC50 is 2.261-2.623 ng/mL. The VLPs is negative control.

Form

Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK