Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active)

This Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active) spans the amino acid sequence from region 1-237aa. Purity: The purity information is not available for VLPs proteins.

Product Specifications

Product Name Alternative

Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029

UniProt

P19075

Expression Region

1-237aa

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

The purity information is not available for VLPs proteins.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/mL can bind Anti-TSPAN8 recombinant antibody. The EC50 is 2.261-2.623 ng/mL. The VLPs is negative control.

Form

Lyophilized powder

Molecular Weight

27.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

AA Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1213099-01 0.02 mg (E-Coli)

Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1213099-02 0.1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1213099-03 0.02 mg (Yeast)

Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1213099-04 0.1 mg (Yeast)

Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1213099-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details
Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)
MBS1213099-06 1 mg (E-Coli)

Recombinant Mycobacterium tuberculosis DNA-directed RNA polymerase subunit omega (rpoZ)

Sign In for Pricing
View Details