Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active)
This Recombinant Human Tetraspanin-8 (TSPAN8) -VLPs (Active) spans the amino acid sequence from region 1-237aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
Product Name Alternative
Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029
UniProt
P19075
Expression Region
1-237aa
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
The purity information is not available for VLPs proteins.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/mL can bind Anti-TSPAN8 recombinant antibody. The EC50 is 2.261-2.623 ng/mL. The VLPs is negative control.
Form
Lyophilized powder
Molecular Weight
27.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal DLL1 Antibody (D1L165-6) [Alexa Fluor 532]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-80048AF532 0.1 mL
Mouse Monoclonal DLL1 Antibody (D1L165-6) [Alexa Fluor 532]
Sign In for Pricing
View Details BG-HUM10830 1 Each
Human Extracellular Signal Regulated Kinase 1 ERK1 ELISA Kit
Sign In for Pricing
View Details 
RC205075L3V 200 µL
MRPL1 (NM_020236) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 