Recombinant Mouse Tumor necrosis factor ligand superfamily member 15 (Tnfsf15), partial (Active)
This Recombinant Mouse Tumor necrosis factor ligand superfamily member 15 (Tnfsf15), partial (Active) spans the amino acid sequence from region 61-252aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor Gene names
UniProt
Q5UBV8
Expression Region
61-252aa
Tag
N-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Mus musculus (Mouse)
Field of Research
Cancer Biology; Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Tnfsf15 at 2 μg/mL can bind Anti-TNFSF15 recombinant antibody. The EC50 is 1.671-2.506 ng/mL.
Form
Lyophilized powder
Molecular Weight
24.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400096-500 1x 500 µL
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740012-500 1x 500 µL
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040043-500 1x 500 µL
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUB0965-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), 0.2mg/mL
Sign In for Pricing
View Details 