Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus 133/2005 Spike glycoprotein (S), partial

This Recombinant Bat coronavirus 133/2005 Spike glycoprotein (S), partial spans the amino acid sequence from region 372-611aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S glycoprotein

UniProt

Q0Q4F2

Expression Region

372-611aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EASATGTFIEQPNVTECDFSPMLTGVAPQVYNFKRLVFSNCNYNLTKLLSLFAVDEFSCNGISPDAIARGCYSTLTVDYFAYPLSMKSYIRPGSAGNIPLYNYKQSFANPTCRVMASVPDNVTITKPGAYGYISKCSRLTGVNQDIETPLYINPGEYSICRDFAPLGFSEDGQVFKRTLTQFEGGGLLIGVGTRVPMTANLEMGFVISVQYGTGTDSVCPMLDLGDSLTITNRLGKCVDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse monoclonal antibody specific for Cytomegalovirus phosphoprotein 28 (clone 0898)
MAB12189-100 1 Each

Mouse monoclonal antibody specific for Cytomegalovirus phosphoprotein 28 (clone 0898)

Sign In for Pricing
View Details
Tubb4a Mouse qPCR Primer Pair (NM_009451)
MP217714 200 Reactions

Tubb4a Mouse qPCR Primer Pair (NM_009451)

Sign In for Pricing
View Details
Aig1 ORF Vector (Mouse) (pORF)
ORF038349 1.0 µg DNA

Aig1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Nr1d1 Mouse shRNA Plasmid (Locus ID 217166)
TR516925 1 Kit

Nr1d1 Mouse shRNA Plasmid (Locus ID 217166)

Sign In for Pricing
View Details
Bcl-x (BX006), CF488A conjugate, 0.1mg/mL
BNC880006-500 1x 500 µL

Bcl-x (BX006), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LRIG1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-1844R-APC-Cy7 100 µL

LRIG1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details