Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Laminin subunit gamma-2 (LAMC2), partial

This Recombinant Human Laminin subunit gamma-2 (LAMC2), partial spans the amino acid sequence from region 417-588aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell-scattering factor 140 kDa subunit; CSF 140 kDa subunit; Epiligrin subunit gamma; Kalinin subunit gamma; Kalinin/nicein/epiligrin 100 kDa subunit; Ladsin 140 kDa subunit; Laminin B2t chain; Laminin-5 subunit gamma; Large adhesive scatter factor 140 kDa subunit; Nicein subunit gamma

UniProt

Q13753

Expression Region

417-588aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NCQGGGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL
BNC401274-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nootkatone
TRC-N650500-5G 5 g

Nootkatone

Sign In for Pricing
View Details
KBTBD7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G3]
TA501391BM 100 µL

KBTBD7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G3]

Sign In for Pricing
View Details
Human TBX5 activation kit by CRISPRa
GA104766 1 Kit

Human TBX5 activation kit by CRISPRa

Sign In for Pricing
View Details
UCP4 (SLC25A27) Human Gene Knockout Kit (CRISPR)
KN421369 1 Kit

UCP4 (SLC25A27) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc22a12 Mouse Gene Knockout Kit (CRISPR)
KN515922 1 Kit

Slc22a12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details