Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Laminin subunit gamma-2 (LAMC2), partial

This Recombinant Human Laminin subunit gamma-2 (LAMC2), partial spans the amino acid sequence from region 417-588aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell-scattering factor 140 kDa subunit; CSF 140 kDa subunit; Epiligrin subunit gamma; Kalinin subunit gamma; Kalinin/nicein/epiligrin 100 kDa subunit; Ladsin 140 kDa subunit; Laminin B2t chain; Laminin-5 subunit gamma; Large adhesive scatter factor 140 kDa subunit; Nicein subunit gamma

UniProt

Q13753

Expression Region

417-588aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NCQGGGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAP30, CT (SAP30, Histone deacetylase complex subunit SAP30, 30kD Sin3-associated polypeptide, Sin3 corepressor complex subunit SAP30, Sin3-associated polypeptide p30) (FITC) discontinued
041397-FITC 200 µL

SAP30, CT (SAP30, Histone deacetylase complex subunit SAP30, 30kD Sin3-associated polypeptide, Sin3 corepressor complex subunit SAP30, Sin3-associated polypeptide p30) (FITC) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Plekhj1 shRNA (UAS) - Lentiviral mouse Plekhj1 shRNA (UAS, iRFP) (25)
GTR15304793 1 Vial

Lentiviral mouse Plekhj1 shRNA (UAS) - Lentiviral mouse Plekhj1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Mtif3 Lentiviral Activation Particles (m)
sc-429306-LAC 200 µL

Mtif3 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Mouse Monoclonal B7-2/CD86 Antibody (BU63) [Alexa Fluor 594]
NBP2-34569AF594 0.1 mL

Mouse Monoclonal B7-2/CD86 Antibody (BU63) [Alexa Fluor 594]

Sign In for Pricing
View Details
Mouse IgG2a Isotype Control Alexa Fluor® 647
A6-458-C100 0.1 mg

Mouse IgG2a Isotype Control Alexa Fluor® 647

Sign In for Pricing
View Details
STYX sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2310506 1.0 µg DNA

STYX sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details