Recombinant Streptococcus agalactiae serotype V Nucleoside diphosphate kinase (ndk)
This Recombinant Streptococcus agalactiae serotype V Nucleoside diphosphate kinase (ndk) spans the amino acid sequence from region 1-138aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
NDK; NDP kinase; Nucleoside-2-P kinase
UniProt
Q8E031
Expression Region
1-138aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Field of Research
Signal Transduction
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
17.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEQTFFMIKPDGVKRGFIGEVISRIERRGFSIDRLEVRYADADILKRHYAELTDRPFFPTLVDYMTSGPVIIGVISGEEVISTWRTMMGSTNPKDALPGTIRGDFAQAPSPNQATCNIVHGSDSPESATREIAIWFNN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682442-500 1x 500 µL
GATA-3 (Breast and Urothelial Marker) (GATA3/2442), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472477-500 1x 500 µL
MMP9 (Matrix Metalloproteinase 9) (MMP9/2477), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC473287-100 1x 100 µL
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3287), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
