Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/threonine-protein phosphatase PGAM5, mitochondrial (PGAM5), partial

This Recombinant Human Serine/threonine-protein phosphatase PGAM5, mitochondrial (PGAM5), partial spans the amino acid sequence from region 30-289aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bcl-XL-binding protein v68; Phosphoglycerate mutase family member 5

UniProt

Q96HS1

Expression Region

30-289aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS11 (Dehydrogenase/Reductase SDR Family Member 11, ARPG836, FLJ39232, MGC4172, SDR24C1, UNQ836/PRO1774)
129645 50 µg

DHRS11 (Dehydrogenase/Reductase SDR Family Member 11, ARPG836, FLJ39232, MGC4172, SDR24C1, UNQ836/PRO1774)

Sign In for Pricing
View Details
4-Butoxy-3-ethoxy-benzaldehyde
sc-277164 1 g

4-Butoxy-3-ethoxy-benzaldehyde

Sign In for Pricing
View Details
Pcdhgc3 3'UTR Luciferase Stable Cell Line
TU116035 1.0 mL

Pcdhgc3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TEF Recombinant Protein (Mouse)
RP178145 100 µg

TEF Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human CAMSAP1 Pre-designed siRNA Set B
SI002144B 1 Each

Human CAMSAP1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
IL1R1, CT (IL1R1, IL1R, IL1RA, IL1RT1, Interleukin-1 receptor type 1, CD121 antigen-like family member A, Interleukin-1 receptor alpha, Interleukin-1 receptor type I, p80, CD121a, Interleukin-1 receptor type 1, membrane form, Interleukin-1 receptor type 1
MBS6310032-01 0.1 mL

IL1R1, CT (IL1R1, IL1R, IL1RA, IL1RT1, Interleukin-1 receptor type 1, CD121 antigen-like family member A, Interleukin-1 receptor alpha, Interleukin-1 receptor type I, p80, CD121a, Interleukin-1 receptor type 1, membrane form, Interleukin-1 receptor type 1

Sign In for Pricing
View Details