Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Hemoglobin subunit beta (HBB)

This Recombinant Macaca fascicularis Hemoglobin subunit beta (HBB) spans the amino acid sequence from region 2-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-globin; Hemoglobin beta chain

UniProt

P68223

Expression Region

2-147aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VHLTPEEKNAVTTLWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLNHLDNLKGTFAQLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKD2 rabbit pAb
ES14484-01 50 µL

NKD2 rabbit pAb

Sign In for Pricing
View Details
NKD2 rabbit pAb
ES14484-02 100 µL

NKD2 rabbit pAb

Sign In for Pricing
View Details
Mouse apolipoprotein E (Apo-E) Elisa Kit
EK732108 96 Well

Mouse apolipoprotein E (Apo-E) Elisa Kit

Sign In for Pricing
View Details
NAP125 Double Nickase Plasmid (h)
sc-404855-NIC 20 µg

NAP125 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
S-RMab® CD43 Recombinant Rabbit mAb,PBS Only (SDT-R101)
S0B2144P-01 1 mg

S-RMab® CD43 Recombinant Rabbit mAb,PBS Only (SDT-R101)

Sign In for Pricing
View Details
S-RMab® CD43 Recombinant Rabbit mAb,PBS Only (SDT-R101)
S0B2144P-02 25 µg

S-RMab® CD43 Recombinant Rabbit mAb,PBS Only (SDT-R101)

Sign In for Pricing
View Details