Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli O6:H1 DNA-binding protein HU-alpha (hupA)

This Recombinant Escherichia coli O6:H1 DNA-binding protein HU-alpha (hupA) spans the amino acid sequence from region 1-90aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HU-2; NS2

UniProt

P0ACF1

Expression Region

1-90aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-100 1x 100 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
BNC740994-100 1x 100 µL

TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF568 conjugate, 0.1mg/mL
BNC680485-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-100 1x 100 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF740 conjugate, 0.1mg/mL
BNC741919-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF640R conjugate, 0.1mg/mL
BNC400828-500 1x 500 µL

CD79a (JCB117 + HM47/A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details