Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Double homeobox protein 4 (DUX4), partial

This Recombinant Human Double homeobox protein 4 (DUX4), partial spans the amino acid sequence from region 327-424aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Double homeobox protein 10

UniProt

Q9UBX2

Expression Region

327-424aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sema6b Mouse Gene Knockout Kit (CRISPR)
KN515509 1 Kit

Sema6b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS638383 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2953), 1mg/mL
BNUM2953-50 1x 50 µL

C1QA / Complement C1q A-Chain (C1QA/2953), 1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Rat) (GZ-20), CF568 conjugate, 0.1mg/mL
BNC680382-500 1x 500 µL

Ep-CAM / CD326 (Rat) (GZ-20), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHA-793887
TRC-P294480-5MG 5 mg

PHA-793887

Sign In for Pricing
View Details
2-Bromo-4-nitrophenol
TRC-B698005-250MG 250 mg

2-Bromo-4-nitrophenol

Sign In for Pricing
View Details