Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Double homeobox protein 4 (DUX4), partial

This Recombinant Human Double homeobox protein 4 (DUX4), partial spans the amino acid sequence from region 327-424aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Double homeobox protein 10

UniProt

Q9UBX2

Expression Region

327-424aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFX5 (NM_001025603) Human Over-expression Lysate
LY422455 100 µg

RFX5 (NM_001025603) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS504703 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Bcl-2 Rabbit Polyclonal Antibody
ER1706-47 100 µL

Bcl-2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTPRS Human Gene Knockout Kit (CRISPR)
KN211163 1 Kit

PTPRS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fructosamine Microplate Assay Kit
RDSM223 100 Assays

Fructosamine Microplate Assay Kit

Sign In for Pricing
View Details
Vmn2r95 Mouse Gene Knockout Kit (CRISPR)
KN519228 1 Kit

Vmn2r95 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details