Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Deoxyribonuclease-1-like 2 (DNASE1L2)

This Recombinant Human Deoxyribonuclease-1-like 2 (DNASE1L2) spans the amino acid sequence from region 21-299aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNase I homolog protein DHP1; Deoxyribonuclease I-like 2; DNase I-like 2

UniProt

Q92874

Expression Region

21-299aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALRIGAFNIQSFGDSKVSDPACGSIIAKILAGYDLALVQEVRDPDLSAVSALMEQINSVSEHEYSFVSSQPLGRDQYKEMYLFVYRKDAVSVVDTYLYPDPEDVFSREPFVVKFSAPGTGERAPPLPSRRALTPPPLPAAAQNLVLIPLHAAPHQAVAEIDALYDVYLDVIDKWGTDDMLFLGDFNADCSYVRAQDWAAIRLRSSEVFKWLIPDSADTTVGNSDCAYDRIVACGARLRRSLKPQSATVHDFQEEFGLDQTQALAISDHFPVEVTLKFHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bicyclo[2.2.1]hept-2-ene
TRC-B382870-5G 5 g

Bicyclo[2.2.1]hept-2-ene

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS623778 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
GOLGA7 (NM_001174124) Human Over-expression Lysate
LY432569 100 µg

GOLGA7 (NM_001174124) Human Over-expression Lysate

Sign In for Pricing
View Details
Ranaconitine (>90%)
TRC-R119000-50MG 50 mg

Ranaconitine (>90%)

Sign In for Pricing
View Details
Propiverine Hydrochloride
TRC-P828000-500MG 500 mg

Propiverine Hydrochloride

Sign In for Pricing
View Details
NT5C3L (NT5C3B) (NM_052935) Human Recombinant Protein
TP304354L 1 mg

NT5C3L (NT5C3B) (NM_052935) Human Recombinant Protein

Sign In for Pricing
View Details